Structure of PDB 2hjk Chain A Binding Site BS01

Receptor Information
>2hjk Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAP
WIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYG
CDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQIIQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
>2hjk Chain C (length=11) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGFNPEVIPMF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hjk Strong TCR Conservation and Altered T Cell Cross-Reactivity Characterize a B*57-Restricted Immune Response in HIV-1 Infection.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
Y7 E63 N66 T73 N77 I80 Y84 Y99 Y123 I143 K146 W147 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 N66 T73 N77 I80 Y84 Y99 Y123 I143 K146 W147 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links