Structure of PDB 2heo Chain A Binding Site BS01

Receptor Information

>2heo Chain A (length=59) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DNLEQKILQVLSDDGGPVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVSSP
SPKYWSIGG

Ligand information

>2heo Chain B (length=6) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgcgcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2heo Structure-based secondary structure-independent approach to design protein ligands: Application to the design of Kv1.2 potassium channel blockers.
Resolution	1.7 Å
Binding residue (original residue number in PDB)	K142 K143 N146 Q147 Y150 K164
Binding residue (residue number reindexed from 1)	K31 K32 N35 Q36 Y39 K53

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003726	double-stranded RNA adenosine deaminase activity

	Biological Process
GO:0060340	positive regulation of type I interferon-mediated signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2heo, PDBe:2heo, PDBj:2heo
PDBsum	2heo
PubMed	17165772
UniProt	Q9QY24\|ZBP1_MOUSE Z-DNA-binding protein 1 (Gene Name=Zbp1)

[Back to BioLiP]