Structure of PDB 2hdd Chain A Binding Site BS01

Receptor Information

>2hdd Chain A (length=55) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKRA
KIKKS

Ligand information

>2hdd Chain C (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttttgccatgtaatccccgga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2hdd Engrailed (Gln50-->Lys) homeodomain-DNA complex at 1.9 A resolution: structural basis for enhanced affinity and altered specificity.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	R5 T6 F8 Q44 N51
Binding residue (residue number reindexed from 1)	R1 T2 F4 Q40 N47
Binding affinity	PDBbind-CN: Kd=8.8pM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2hdd, PDBe:2hdd, PDBj:2hdd
PDBsum	2hdd
PubMed	9309220
UniProt	P02836\|HMEN_DROME Segmentation polarity homeobox protein engrailed (Gene Name=en)

[Back to BioLiP]