Structure of PDB 2hax Chain A Binding Site BS01

Receptor Information

>2hax Chain A (length=66) Species: 1394 ([Bacillus] caldolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFE
IVQGNRGPQAANVVKL

Ligand information

>2hax Chain C (length=6) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tttttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2hax Common mode of DNA binding to cold shock domains. Crystal structure of hexathymidine bound to the domain-swapped form of a major cold shock protein from Bacillus caldolyticus.
Resolution	1.29 Å
Binding residue (original residue number in PDB)	W8 N10 N11 E12 K13 G14 Y15 F17 D25 F27 H29 F30
Binding residue (residue number reindexed from 1)	W8 N10 N11 E12 K13 G14 Y15 F17 D25 F27 H29 F30

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003677	DNA binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:2hax, PDBe:2hax, PDBj:2hax
PDBsum	2hax
PubMed	17266726
UniProt	P41016\|CSPB_BACCL Cold shock protein CspB (Gene Name=cspB)

[Back to BioLiP]