Structure of PDB 2h6t Chain A Binding Site BS01

Receptor Information

>2h6t Chain A (length=340) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QTVPVKLINEQVSYASDITVGSNKQKLTVVIDTGSSDLWVPDSQVSCQAG
QGQDPNFCKNEGTYSPSSSSSSQNLNSPFSIEYGDGTTSQGTWYKDTIGF
GGISITKQQFADVTSTSVDQGILGIGYKTHEAEGNYDNVPVTLKNQGIIS
KNAYSLYLNSRQATSGQIIFGGVDNAKYSGTLIALPVTSDNELRIHLNTV
KVAGQSINADVDVLLDSGTTITYLQQGVADQVISAFNGQETYDANGNLFY
LVDCNLSGSVDFAFDKNAKISVPASEFTAPLYTEDGQVYDQCQLLFGTSD
YNILGDNFLRSAYIVYDLDDNEISLAQVKYTTASNIAALT

Ligand information

>2h6t Chain B (length=6) Species: 285516 (Streptomyces argenteolus subsp. toyonakensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VVVLAL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2h6t The crystal structure of the secreted aspartic proteinase 3 from Candida albicans and its complex with pepstatin A.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	D32 G34 S35 E83 Y84 G85 D86 D218 G220 T221 T222 Y303
Binding residue (residue number reindexed from 1)	D32 G34 S35 E82 Y83 G84 D85 D216 G218 T219 T220 Y301

Enzymatic activity

Catalytic site (original residue number in PDB)	D32 S35 D37 W39 Y84 D218 T221
Catalytic site (residue number reindexed from 1)	D32 S35 D37 W39 Y83 D216 T219
Enzyme Commision number	3.4.23.24: candidapepsin.

Gene Ontology

	Molecular Function
GO:0004190	aspartic-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2h6t, PDBe:2h6t, PDBj:2h6t
PDBsum	2h6t
PubMed	17510964
UniProt	P0CY29\|CARP3_CANAL Secreted aspartic protease 3 (Gene Name=SAP3)

[Back to BioLiP]