Structure of PDB 2h6i Chain A Binding Site BS01

Receptor Information
>2h6i Chain A (length=315) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFR
AVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNY
ITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQ
HRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRA
VLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQP
SHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKE
YWRYIGRSLQSKHST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h6i Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y166 Q167
Binding residue
(residue number reindexed from 1)		Y112 Q113
Enzymatic activity
Catalytic site (original residue number in PDB) K164
Catalytic site (residue number reindexed from 1) K110
Enzyme Commision number 2.5.1.58: protein farnesyltransferase.
2.5.1.59: protein geranylgeranyltransferase type I.
Gene Ontology
Molecular Function
GO:0004659 prenyltransferase activity
GO:0004660 protein farnesyltransferase activity
GO:0004661 protein geranylgeranyltransferase activity
GO:0004662 CAAX-protein geranylgeranyltransferase activity
GO:0004663 Rab geranylgeranyltransferase activity
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008318 protein prenyltransferase activity
GO:0030971 receptor tyrosine kinase binding
GO:0043014 alpha-tubulin binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0007167 enzyme-linked receptor protein signaling pathway
GO:0007179 transforming growth factor beta receptor signaling pathway
GO:0007528 neuromuscular junction development
GO:0018342 protein prenylation
GO:0018343 protein farnesylation
GO:0018344 protein geranylgeranylation
GO:0035022 positive regulation of Rac protein signal transduction
GO:0071340 skeletal muscle acetylcholine-gated channel clustering
GO:0090044 positive regulation of tubulin deacetylation
GO:0090045 positive regulation of deacetylase activity
GO:1904395 positive regulation of skeletal muscle acetylcholine-gated channel clustering
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005875 microtubule associated complex
GO:0005886 plasma membrane
GO:0005953 CAAX-protein geranylgeranyltransferase complex
GO:0005965 protein farnesyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2h6i, PDBe:2h6i, PDBj:2h6i
PDBsum2h6i
PubMed16893176
UniProtP49354|FNTA_HUMAN Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha (Gene Name=FNTA)

[Back to BioLiP]