Structure of PDB 2h5k Chain A Binding Site BS01

Receptor Information
>2h5k Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQ
HFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h5k Structural and energetic aspects of Grb2-SH2 domain-swapping.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		R67 R86 S88 S90 S96 Q106 H107 F108 K109 L120
Binding residue
(residue number reindexed from 1)		R11 R30 S32 S34 S40 Q50 H51 F52 K53 L64
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2h5k, PDBe:2h5k, PDBj:2h5k
PDBsum2h5k
PubMed17466257
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]