Structure of PDB 2h2f Chain A Binding Site BS01

Receptor Information
>2h2f Chain A (length=234) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKMKEFLDLLNESRLTVTLTGAGISTPSGIPDQNVFDIDFFYSHPEEFYR
FAKEGIFPMLQAKPNLAHVLLAKLEEKGLIEAVITQNIDRLHQRAGSKKV
IELHGNVEEYYCVRCEKKYTVEDVIKKLESSDVPLCDDCNSLIRPNIVFF
GENLPQDALREAIGLSSRASLMIVLGSSLVVYPAAELPLITVRSGGKLVI
VNLGETPFDDIATLKYNMDVVEFARRVMEEGGIS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h2f The structural basis of sirtuin substrate affinity
Resolution2.2 Å
Binding residue
(original residue number in PDB)		V160 F162 G163 E164 N165 L166 V193 Y194 P195
Binding residue
(residue number reindexed from 1)		V148 F150 G151 E152 N153 L154 V181 Y182 P183
Enzymatic activity
Catalytic site (original residue number in PDB) P31 D32 N99 D101 H116
Catalytic site (residue number reindexed from 1) P31 D32 N87 D89 H104
Enzyme Commision number 2.3.1.286: protein acetyllysine N-acetyltransferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0016740 transferase activity
GO:0017136 NAD-dependent histone deacetylase activity
GO:0034979 NAD-dependent protein lysine deacetylase activity
GO:0046872 metal ion binding
GO:0051287 NAD binding
GO:0070403 NAD+ binding
Biological Process
GO:0006338 chromatin remodeling
GO:0006476 protein deacetylation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2h2f, PDBe:2h2f, PDBj:2h2f
PDBsum2h2f
PubMed16768447
UniProtQ9WYW0|NPD_THEMA NAD-dependent protein deacetylase (Gene Name=cobB)

[Back to BioLiP]