Structure of PDB 2h1o Chain A Binding Site BS01

Receptor Information
>2h1o Chain A (length=143) Species: 485 (Neisseria gonorrhoeae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAEMRLGVALL
LNGKKKNVLHERMEQSILPLFAGRILPFDEPVAAIYAQIRSYAKTHGKEI
AAADGYIAATAKQHSMTVATRDTGSFFAADVAVFNPWHLEHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h1o Structure of FitAB from Neisseria gonorrhoeae bound to DNA reveals a tetramer of toxin-antitoxin heterodimers containing pin domains and ribbon-helix-helix motifs.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		H142 H143
Binding residue
(residue number reindexed from 1)		H142 H143
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0004518 nuclease activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0044001 migration in host

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2h1o, PDBe:2h1o, PDBj:2h1o
PDBsum2h1o
PubMed16982615
UniProtQ5F882|FITB_NEIG1 Toxin FitB (Gene Name=fitB)

[Back to BioLiP]