Structure of PDB 2h1k Chain A Binding Site BS01

Receptor Information

>2h1k Chain A (length=58) Species: 10036 (Mesocricetus auratus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNR
RMKWKKEE

Ligand information

>2h1k Chain C (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agaaactcattagag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2h1k Structural basis for induced fit mechanisms in DNA recognition by the pdx1 homeodomain
Resolution	2.42 Å
Binding residue (original residue number in PDB)	R5 Y25 R31 K46 Q50 R53 M54 K57
Binding residue (residue number reindexed from 1)	R3 Y23 R29 K44 Q48 R51 M52 K55
Binding affinity	PDBbind-CN: Kd=1.2nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2h1k, PDBe:2h1k, PDBj:2h1k
PDBsum	2h1k
PubMed	17315980
UniProt	P70118\|PDX1_MESAU Pancreas/duodenum homeobox protein 1 (Gene Name=PDX1)

[Back to BioLiP]