Structure of PDB 2gxb Chain A Binding Site BS01

Receptor Information
>2gxb Chain A (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQ
KEAGTPPLWKIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gxb A Left-Handed RNA Double Helix Bound by the Zalpha Domain of the RNA-Editing Enzyme ADAR1.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		K170 N173 R174 Y177 T191 P192 P193
Binding residue
(residue number reindexed from 1)		K34 N37 R38 Y41 T55 P56 P57
Enzymatic activity
Enzyme Commision number 3.5.4.37: double-stranded RNA adenine deaminase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity

View graph for
Molecular Function
External links
PDB RCSB:2gxb, PDBe:2gxb, PDBj:2gxb
PDBsum2gxb
PubMed17437712
UniProtP55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase (Gene Name=ADAR)

[Back to BioLiP]