Structure of PDB 2gww Chain A Binding Site BS01

Receptor Information
>2gww Chain A (length=259) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQA
AVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDP
YSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAE
VVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVK
ELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQ
LTSWDEDAW
Ligand information
>2gww Chain B (length=22) Species: 623 (Shigella flexneri) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NNIYKAAKDVTTSLSKVLKNIN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gww Shigella applies molecular mimicry to subvert vinculin and invade host cells.
Resolution2.72 Å
Binding residue
(original residue number in PDB)		I12 V16 Q19 P43 A46 V47 A50 V57 T61 S112 F126
Binding residue
(residue number reindexed from 1)		I13 V17 Q20 P44 A47 V48 A51 V58 T62 S113 F127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2gww, PDBe:2gww, PDBj:2gww
PDBsum2gww
PubMed17088427
UniProtP18206|VINC_HUMAN Vinculin (Gene Name=VCL)

[Back to BioLiP]