Structure of PDB 2gvf Chain A Binding Site BS01

Receptor Information
>2gvf Chain A (length=183) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCI
NGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCT
CGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAG
HAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Ligand information
>2gvf Chain B (length=22) Species: 11104 (Hepatitis C virus (isolate 1)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGSVVIVGRIVLSGKPAIIPKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gvf P2-P4 macrocyclic inhibitors of hepatitis C virus NS3-4A serine protease.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		M-1 T4 A5 Y6 A7 Q8 Q9 T10 R11 C16 S20 E30 E32 V33 Q34 I35 V36 S37 R62 T63 I64 A65 V107 R109
Binding residue
(residue number reindexed from 1)		M1 T6 A7 Y8 A9 Q10 Q11 T12 R13 C18 S22 E32 E34 V35 Q36 I37 V38 S39 R64 T65 I66 A67 V109 R111
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 S139
Catalytic site (residue number reindexed from 1) H59 D83 G139 S141
Enzyme Commision number 2.7.7.48: RNA-directed RNA polymerase.
3.4.21.98: hepacivirin.
3.4.22.-
3.6.1.15: nucleoside-triphosphate phosphatase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0019087 transformation of host cell by virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2gvf, PDBe:2gvf, PDBj:2gvf
PDBsum2gvf
PubMed16730985
UniProtP26664|POLG_HCV1 Genome polyprotein

[Back to BioLiP]