Structure of PDB 2gs0 Chain A Binding Site BS01

Receptor Information
>2gs0 Chain A (length=115) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQA
TPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNI
KMTLQQIISRYKDAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gs0 Structure of the Tfb1/p53 complex: Insights into the interaction between the p62/Tfb1 subunit of TFIIH and the activation domain of p53.
ResolutionN/A
Binding residue
(original residue number in PDB)
A50 T51 S55 K57 M59 R61 M88
Binding residue
(residue number reindexed from 1)
A50 T51 S55 K57 M59 R61 M88
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2gs0, PDBe:2gs0, PDBj:2gs0
PDBsum2gs0
PubMed16793543
UniProtP32776|TFB1_YEAST General transcription and DNA repair factor IIH subunit TFB1 (Gene Name=TFB1)

[Back to BioLiP]