Structure of PDB 2glo Chain A Binding Site BS01

Receptor Information
>2glo Chain A (length=59) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSRRIFTPHFKLQVLESYRNDNDCKGNQRATARKYNIHRRQIQKWLQCES
NLRSSVANN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2glo DNA recognition by the brinker repressor - an extreme case of coupling between binding and folding
ResolutionN/A
Binding residue
(original residue number in PDB)		R45 N69 Q70 R71 R81 R82 Q85 K86
Binding residue
(residue number reindexed from 1)		R3 N27 Q28 R29 R39 R40 Q43 K44
Binding affinityPDBbind-CN: Kd=30nM
Enzymatic activity
Enzyme Commision number ?
External links