Structure of PDB 2gli Chain A Binding Site BS01

Receptor Information
>2gli Chain A (length=155) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFK
AQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMC
EHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHV
KTVHG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gli Crystal structure of a five-finger GLI-DNA complex: new perspectives on zinc fingers.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y155 Y200 S215 K219 S246 R249
Binding residue
(residue number reindexed from 1)		Y53 Y98 S113 K117 S144 R147
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2gli, PDBe:2gli, PDBj:2gli
PDBsum2gli
PubMed8378770
UniProtP08151|GLI1_HUMAN Zinc finger protein GLI1 (Gene Name=GLI1)

[Back to BioLiP]