Structure of PDB 2gkd Chain A Binding Site BS01

Receptor Information

>2gkd Chain A (length=155) Species: 1877 (Micromonospora echinospora) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NYDPFVRHSVTVKADRKTAFKTFLEGFPEWWPNNFRTTKVGAPLGVDKKG
GRWYEIDEQGEEHTFGLIRKVDEPDTLVIGWRLNGFGRIDPDNSSEFTVT
FVADGQKKTRVDVEHTHFDRMGTKHAKRVRNGMDKGWPTILQSFQDKIDE
EGAKK

Ligand information

>2gkd Chain B (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcatatgatag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2gkd Structural insight into the self-sacrifice mechanism of enediyne resistance.
Resolution	N/A
Binding residue (original residue number in PDB)	G87 R130 N131
Binding residue (residue number reindexed from 1)	G87 R130 N131
Binding affinity	PDBbind-CN: Kd=14uM

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:2gkd, PDBe:2gkd, PDBj:2gkd
PDBsum	2gkd
PubMed	17168523
UniProt	Q8KNF0

[Back to BioLiP]