Structure of PDB 2ggm Chain A Binding Site BS01

Receptor Information
>2ggm Chain A (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMI
SEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISF
KNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ggm The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
E105 L112 F113 L126 E132 L133 M145 A149 M166 T169 L171 Y172
Binding residue
(residue number reindexed from 1)
E82 L89 F90 L103 E109 L110 M122 A126 M143 T146 L148 Y149
Enzymatic activity
Catalytic site (original residue number in PDB) A56
Catalytic site (residue number reindexed from 1) A33
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0032795 heterotrimeric G-protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0007099 centriole replication
GO:0007283 spermatogenesis
GO:0015031 protein transport
GO:0032465 regulation of cytokinesis
GO:0051028 mRNA transport
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005814 centriole
GO:0005815 microtubule organizing center
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005929 cilium
GO:0032391 photoreceptor connecting cilium
GO:0036064 ciliary basal body
GO:0044615 nuclear pore nuclear basket
GO:0045177 apical part of cell
GO:0070390 transcription export complex 2
GO:0071942 XPC complex
GO:0097729 9+2 motile cilium

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2ggm, PDBe:2ggm, PDBj:2ggm
PDBsum2ggm
PubMed16627479
UniProtP41208|CETN2_HUMAN Centrin-2 (Gene Name=CETN2)

[Back to BioLiP]