Structure of PDB 2geq Chain A Binding Site BS01

Receptor Information

>2geq Chain A (length=188) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QKTYQGNYGFHLGFLQSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAG
SRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPE
YLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTI
ITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKK

Ligand information

>2geq Chain C (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgtgagcatgctcac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2geq Structure of the p53 Core Domain Dimer Bound to DNA.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	S238 R270 A273 R277
Binding residue (residue number reindexed from 1)	S137 R169 A172 R176

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2geq, PDBe:2geq, PDBj:2geq
PDBsum	2geq
PubMed	16717092
UniProt	P02340\|P53_MOUSE Cellular tumor antigen p53 (Gene Name=Tp53)

[Back to BioLiP]