Structure of PDB 2gdc Chain A Binding Site BS01

Receptor Information
>2gdc Chain A (length=238) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVFHTRTIESILEPVAQQISHGKAIPDLTAPVSAVQAAVSNLVRVGKETV
QTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGS
RGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTK
NLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIF
VTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQL
Ligand information
>2gdc Chain B (length=21) Species: 623 (Shigella flexneri) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAIYAAAKAVAAALSKVLAAI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gdc Structural mimicry for vinculin activation by IpaA, a virulence factor of Shigella flexneri.
Resolution2.74 Å
Binding residue
(original residue number in PDB)		I12 Q19 P43 A46 V47 A50 L54 V57 I115 L123 F126
Binding residue
(residue number reindexed from 1)		I11 Q18 P31 A34 V35 A38 L42 V45 I103 L111 F114
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2gdc, PDBe:2gdc, PDBj:2gdc
PDBsum2gdc
PubMed16826238
UniProtP12003|VINC_CHICK Vinculin (Gene Name=VCL)

[Back to BioLiP]