Structure of PDB 2gbq Chain A Binding Site BS01

Receptor Information
>2gbq Chain A (length=57) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPK
NYIEMKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gbq Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y7 D15 D33 N35 W36 F47 P49 N51 Y52
Binding residue
(residue number reindexed from 1)		Y7 D15 D33 N35 W36 F47 P49 N51 Y52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2gbq, PDBe:2gbq, PDBj:2gbq
PDBsum2gbq
PubMed9135122
UniProtQ60631|GRB2_MOUSE Growth factor receptor-bound protein 2 (Gene Name=Grb2)

[Back to BioLiP]