Structure of PDB 2g8w Chain A Binding Site BS01

Receptor Information
>2g8w Chain A (length=134) Species: 86665 (Halalkalibacterium halodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGE
FLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIW
KLVDEAEEWLNTHTYETPILKWQTDKWGAIKADY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2g8w Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		D132 S133 Q134 K180
Binding residue
(residue number reindexed from 1)		D73 S74 Q75 K121
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2g8w, PDBe:2g8w, PDBj:2g8w
PDBsum2g8w
PubMed16601679
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]