Structure of PDB 2g8k Chain A Binding Site BS01

Receptor Information
>2g8k Chain A (length=136) Species: 86665 (Halalkalibacterium halodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEF
LAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWK
LVDEAEEWLNTHTYETPILKWQTDKWGEIKANYGRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2g8k Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		N105 E109 D132 Q134 K180 T183
Binding residue
(residue number reindexed from 1)		N45 E49 D72 Q74 K120 T123
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2g8k, PDBe:2g8k, PDBj:2g8k
PDBsum2g8k
PubMed16601679
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]