Structure of PDB 2g5l Chain A Binding Site BS01

Receptor Information
>2g5l Chain A (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEANAWKSTLVGHDTFTKVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2g5l High resolution structure of Streptavidin in complex with a novel high affinity peptide tag mimicking the biotin binding motif
Resolution1.15 Å
Binding residue
(original residue number in PDB)		L25 S27 Y43 S45 A46 W79 S88 T90 W108 L110 S112 D128
Binding residue
(residue number reindexed from 1)		L11 S13 Y29 S31 A32 W65 S74 T76 W94 L96 S98 D114
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2g5l, PDBe:2g5l, PDBj:2g5l
PDBsum2g5l
PubMed
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]