Structure of PDB 2g46 Chain A Binding Site BS01

Receptor Information
>2g46 Chain A (length=119) Species: 10506 (Paramecium bursaria Chlorella virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDY
LFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEE
ITISYGDDYWLSRPRLTQN
Ligand information
>2g46 Chain C (length=21) Species: 4097 (Nicotiana tabacum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKAPRKQLATKAARKSAPATG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2g46 Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
ResolutionN/A
Binding residue
(original residue number in PDB)		E48 L51 F52 S53 K55 R77 Y105 D108 Y109
Binding residue
(residue number reindexed from 1)		E48 L51 F52 S53 K55 R77 Y105 D108 Y109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008168 methyltransferase activity
GO:0042802 identical protein binding
GO:0062122 histone H3K37 methyltransferase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0032259 methylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2g46, PDBe:2g46, PDBj:2g46
PDBsum2g46
PubMed16603186
UniProtO41094

[Back to BioLiP]