Structure of PDB 2g30 Chain A Binding Site BS01

Receptor Information
>2g30 Chain A (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFA
IQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQ
VAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQI
KECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELR
IQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2g30 Molecular Switches Involving the AP-2 beta2 Appendage Regulate Endocytic Cargo Selection and Clathrin Coat Assembly
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R834 Q835 L838 W841 E849 A877 R879 V881 E882 Y888 E902 S915
Binding residue
(residue number reindexed from 1)		R130 Q131 L134 W137 E145 A173 R175 V177 E178 Y184 E198 S211
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030117 membrane coat
GO:0030131 clathrin adaptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2g30, PDBe:2g30, PDBj:2g30
PDBsum2g30
PubMed16516836
UniProtP63010|AP2B1_HUMAN AP-2 complex subunit beta (Gene Name=AP2B1)

[Back to BioLiP]