Structure of PDB 2fy1 Chain A Binding Site BS01

Receptor Information
>2fy1 Chain A (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGF
AFITFENPADAKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASS
RNRSPSGS
Ligand information
>2fy1 Chain B (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacuguccacaagacagucc
<<<<<<<.......>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2fy1 The testis-specific human protein RBMY recognizes RNA through a novel mode of interaction.
ResolutionN/A
Binding residue
(original residue number in PDB)		K9 F11 G13 G14 R17 L38 I40 D42 R43 T44 K46 R48 F50 F52 K79 E81 A83 K84 P86
Binding residue
(residue number reindexed from 1)		K9 F11 G13 G14 R17 L38 I40 D42 R43 T44 K46 R48 F50 F52 K79 E81 A83 K84 P86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2fy1, PDBe:2fy1, PDBj:2fy1
PDBsum2fy1
PubMed17318228
UniProtP0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 (Gene Name=RBMY1A1)

[Back to BioLiP]