Structure of PDB 2fuu Chain A Binding Site BS01

Receptor Information
>2fuu Chain A (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDE
YVCPQCQSTEDA
Ligand information
>2fuu Chain B (length=15) Species: 7650 (Hemicentrotus pulcherrimus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQTARKSTGGKA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2fuu Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y10 Y17 Y23 G25 C26 D27 Q30 W32 A45 I48 D49 E50 Y51
Binding residue
(residue number reindexed from 1)		Y10 Y17 Y23 G25 C26 D27 Q30 W32 A45 I48 D49 E50 Y51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0016589 NURF complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2fuu, PDBe:2fuu, PDBj:2fuu
PDBsum2fuu
PubMed16728978
UniProtQ12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF (Gene Name=BPTF)

[Back to BioLiP]