Structure of PDB 2fsa Chain A Binding Site BS01

Receptor Information
>2fsa Chain A (length=168) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQ
CQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDY
YGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFY
QCAEVLESFFVQKLKGFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2fsa Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y10 Y17 E19 F22 Y23 I24 G25 C26 D27 W32 I48 D49
Binding residue
(residue number reindexed from 1)		Y5 Y12 E14 F17 Y18 I19 G20 C21 D22 W27 I43 D44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0016589 NURF complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2fsa, PDBe:2fsa, PDBj:2fsa
PDBsum2fsa
PubMed16728978
UniProtQ12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF (Gene Name=BPTF)

[Back to BioLiP]