Structure of PDB 2fo4 Chain A Binding Site BS01

Receptor Information
>2fo4 Chain A (length=274) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRAR
WMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISG
CEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQA
GEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVT
LRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVP
LGKEQYYTCHVYHQGLPEPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2fo4 Enhanced major histocompatibility complex class I binding and immune responses through anchor modification of the non-canonical tumour-associated mucin 1-8 peptide
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y7 V9 E63 K66 N70 S73 F74 D77 Y84 T143 W147 E152 R155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 V9 E63 K66 N70 S73 F74 D77 Y84 T143 W147 E152 R155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links