Structure of PDB 2fm2 Chain A Binding Site BS01

Receptor Information
>2fm2 Chain A (length=181) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCING
VCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCG
SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHA
VGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Ligand information
>2fm2 Chain B (length=21) Species: 2847144 (hepatitis C virus genotype 1a) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGSVVIVGRIVLSGKPAIIPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2fm2 Mutations conferring resistance to SCH6, a novel hepatitis C virus NS3/4A protease inhibitor. Reduced RNA replication fitness and partial rescue by second-site mutations
Resolution2.7 Å
Binding residue
(original residue number in PDB)		T4 A5 Y6 A7 Q8 Q9 T10 R11 C16 S20 Q28 E30 E32 V33 I35 V36 S37 T61 R62 T63 I64 A65 R92 R109
Binding residue
(residue number reindexed from 1)		T4 A5 Y6 A7 Q8 Q9 T10 R11 C16 S20 Q28 E30 E32 V33 I35 V36 S37 T61 R62 T63 I64 A65 R92 R109
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 S139
Catalytic site (residue number reindexed from 1) H57 D81 G137 S139
Enzyme Commision number 3.4.21.98: hepacivirin.
3.6.1.15: nucleoside-triphosphate phosphatase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0019087 transformation of host cell by virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2fm2, PDBe:2fm2, PDBj:2fm2
PDBsum2fm2
PubMed16352601
UniProtQ9ELS8

[Back to BioLiP]