Structure of PDB 2fka Chain A Binding Site BS01

Receptor Information
>2fka Chain A (length=128) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGF
GFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQA
GASGYVVKPFTAATLEEKLNKIFEKLGM
Ligand information
>2fka Chain B (length=10) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VDDLLDSLGF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2fka Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
I95 A103 G105 Y106 K119
Binding residue
(residue number reindexed from 1)
I94 A102 G104 Y105 K118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006935 chemotaxis
GO:0097588 archaeal or bacterial-type flagellum-dependent cell motility
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2fka, PDBe:2fka, PDBj:2fka
PDBsum2fka
PubMed16674976
UniProtP0A2D5|CHEY_SALTY Chemotaxis protein CheY (Gene Name=cheY)

[Back to BioLiP]