Structure of PDB 2fib Chain A Binding Site BS01

Receptor Information
>2fib Chain A (length=250) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWT
VFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAI
PYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDG
FDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAG
HLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2fib The primary fibrin polymerization pocket: three-dimensional structure of a 30-kDa C-terminal gamma chain fragment complexed with the peptide Gly-Pro-Arg-Pro.
Resolution2.01 Å
Binding residue
(original residue number in PDB)		F295 D297 D301 T305 F322 Q329 K338 C339 H340 D364
Binding residue
(residue number reindexed from 1)		F153 D155 D159 T163 F180 Q187 K196 C197 H198 D222
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007596 blood coagulation

View graph for
Biological Process
External links
PDB RCSB:2fib, PDBe:2fib, PDBj:2fib
PDBsum2fib
PubMed9207064
UniProtP02679|FIBG_HUMAN Fibrinogen gamma chain (Gene Name=FGG)

[Back to BioLiP]