Structure of PDB 2ff0 Chain A Binding Site BS01

Receptor Information
>2ff0 Chain A (length=102) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDK
TQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK
KA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ff0 Sequence-specific deoxyribonucleic Acid (DNA) recognition by steroidogenic factor 1: a helix at the carboxy terminus of the DNA binding domain is necessary for complex stability.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y23 H24 Y25 K34 K38 Q42 A82 V83 R84 R87 M88 R89 G91 R92 Y99 R103
Binding residue
(residue number reindexed from 1)		Y14 H15 Y16 K25 K29 Q33 A73 V74 R75 R78 M79 R80 G82 R83 Y90 R94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0004879 nuclear receptor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ff0, PDBe:2ff0, PDBj:2ff0
PDBsum2ff0
PubMed16339274
UniProtP33242|STF1_MOUSE Steroidogenic factor 1 (Gene Name=Nr5a1)

[Back to BioLiP]