Structure of PDB 2fci Chain A Binding Site BS01

Receptor Information
>2fci Chain A (length=105) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPGIHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFR
AEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPIN
EENSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2fci Structural basis for the requirement of two phosphotyrosine residues in signaling mediated by syk tyrosine kinase
ResolutionN/A
Binding residue
(original residue number in PDB)
R18 A19 R37 R39 N40 F49 K54 I55 K56 C58 R59 L69 G70 N71 Y84 Y90
Binding residue
(residue number reindexed from 1)
R18 A19 R37 R39 N40 F49 K54 I55 K56 C58 R59 L69 G70 N71 Y84 Y90
Enzymatic activity
Enzyme Commision number 3.1.4.11: phosphoinositide phospholipase C.
External links
PDB RCSB:2fci, PDBe:2fci, PDBj:2fci
PDBsum2fci
PubMed16410013
UniProtP08487|PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 (Gene Name=PLCG1)

[Back to BioLiP]