Structure of PDB 2f8k Chain A Binding Site BS01

Receptor Information
>2f8k Chain A (length=84) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLE
KKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2f8k Sequence-specific recognition of RNA hairpins by the SAM domain of Vts1p.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K461 R464 L465 H466 K467 A495 L496 G497 R500
Binding residue
(residue number reindexed from 1)		K22 R25 L26 H27 K28 A56 L57 G58 R61
Binding affinityPDBbind-CN: Kd=25nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043488 regulation of mRNA stability

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2f8k, PDBe:2f8k, PDBj:2f8k
PDBsum2f8k
PubMed16429151
UniProtQ08831|VTS1_YEAST RNA-binding protein VTS1 (Gene Name=VTS1)

[Back to BioLiP]