Structure of PDB 2f31 Chain A Binding Site BS01

Receptor Information

>2f31 Chain A (length=228) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SAMMYIQELRSGLRDMHLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD
ILKRLHDEKNYDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAM
DPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPL
LDGLKSGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQ
ELREIENEDMKVQLCVFDEQGDEDFFDL

Ligand information

>2f31 Chain B (length=20) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DETGVMDSLLEALQSGAAFR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2f31 Structure of the Autoinhibitory Switch in Formin mDia1
Resolution	2.1 Å
Binding residue (original residue number in PDB)	N217 N218 L253 S255 A256 I259 N310 A311 T314 V351 Q352 V355
Binding residue (residue number reindexed from 1)	N78 N79 L114 S116 A117 I120 N171 A172 T175 V212 Q213 V216

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003779	actin binding
GO:0031267	small GTPase binding

	Biological Process
GO:0016043	cellular component organization
GO:0030036	actin cytoskeleton organization

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2f31, PDBe:2f31, PDBj:2f31
PDBsum	2f31
PubMed	16472745
UniProt	Q3US76

[Back to BioLiP]