Structure of PDB 2ewj Chain A Binding Site BS01

Receptor Information
>2ewj Chain A (length=305) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLN
RIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDN
LSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLN
AYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWT
REEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHA
CPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLH
LYVAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ewj A molecular mousetrap determines polarity of termination of DNA replication in E. coli.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		S88 K89 T129 F140 H144 G149 L153 Y156 R169 A173 N174 K175 H176 I177 I178 K179 N180 K229 R241 W243 Q250 V285 H287 R288 P291 A293
Binding residue
(residue number reindexed from 1)		S84 K85 T125 F136 H140 G145 L149 Y152 R165 A169 N170 K171 H172 I173 I174 K175 N176 K225 R237 W239 Q246 V281 H283 R284 P287 A289
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006274 DNA replication termination
GO:0071807 replication fork arrest involved in DNA replication termination
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ewj, PDBe:2ewj, PDBj:2ewj
PDBsum2ewj
PubMed16814717
UniProtP16525|TUS_ECOLI DNA replication terminus site-binding protein (Gene Name=tus)

[Back to BioLiP]