Structure of PDB 2es2 Chain A Binding Site BS01

Receptor Information
>2es2 Chain A (length=67) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFE
IVEGNRGPQAANVTKEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2es2 T-rich DNA single strands bind to a preformed site on the bacterial cold shock protein Bs-CspB.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		K7 W8 F15 F17 D25 F27 H29 R56 Q59
Binding residue
(residue number reindexed from 1)		K7 W8 F15 F17 D25 F27 H29 R56 Q59
Binding affinityPDBbind-CN: Kd=326nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
Biological Process
GO:0010468 regulation of gene expression
Cellular Component
GO:0005737 cytoplasm
GO:0009295 nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2es2, PDBe:2es2, PDBj:2es2
PDBsum2es2
PubMed16780871
UniProtP32081|CSPB_BACSU Cold shock protein CspB (Gene Name=cspB)

[Back to BioLiP]