Structure of PDB 2erg Chain A Binding Site BS01

Receptor Information

>2erg Chain A (length=65) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FACVECRQQKSKCDACERAPEPCTKCAKKNVPCILKRDFRRTYKRARNEA
IEKRFKELTRTLTNL

Ligand information

>2erg Chain C (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttgccggtaccggca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2erg Structure of a Leu3-DNA complex: recognition of everted CGG half-sites by a Zn2Cys6 binuclear cluster protein.
Resolution	3.15 Å
Binding residue (original residue number in PDB)	F35 A36 R41 K44 R79
Binding residue (residue number reindexed from 1)	F1 A2 R7 K10 R45
Binding affinity	PDBbind-CN: Kd=25nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008270	zinc ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2erg, PDBe:2erg, PDBj:2erg
PDBsum	2erg
PubMed	16615914
UniProt	P08638\|LEUR_YEAST Regulatory protein LEU3 (Gene Name=LEU3)

[Back to BioLiP]