Structure of PDB 2egn Chain A Binding Site BS01

Receptor Information
>2egn Chain A (length=83) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQRKVLTLEKGDNQTFGFEIQTYGVTFVARVHESSPAQLAGLTPGDTIAS
VNGLNVEGIRHREIVDIIKASGNVLRLETLYGT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2egn Crystal structures of autoinhibitory PDZ domain of Tamalin: implications for metabotropic glutamate receptor trafficking regulation
Resolution2.4 Å
Binding residue
(original residue number in PDB)
Y187 T189
Binding residue
(residue number reindexed from 1)
Y81 T83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2egn, PDBe:2egn, PDBj:2egn
PDBsum2egn
PubMed17396155
UniProtQ8R4T5|GRASP_RAT General receptor for phosphoinositides 1-associated scaffold protein (Gene Name=Tamalin)

[Back to BioLiP]