Structure of PDB 2e4h Chain A Binding Site BS01

Receptor Information
>2e4h Chain A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAG
TRYFQCQPKYGLFAPVHKVTKIGF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2e4h Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
ResolutionN/A
Binding residue
(original residue number in PDB)
F236 W241 K252 N253 L271 F272 P274 K277
Binding residue
(residue number reindexed from 1)
F27 W32 K43 N44 L62 F63 P65 K68
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2e4h, PDBe:2e4h, PDBj:2e4h
PDBsum2e4h
PubMed17563362
UniProtP30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 (Gene Name=CLIP1)

[Back to BioLiP]