Structure of PDB 2e43 Chain A Binding Site BS01

Receptor Information
>2e43 Chain A (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQL
SRELSTLRNLFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2e43 Structural Basis for Flexible Base Recognition by C/Ebpbeta
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y274 R278 N282 R289 K293
Binding residue
(residue number reindexed from 1)		Y4 R8 N12 R19 K23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2e43, PDBe:2e43, PDBj:2e43
PDBsum2e43
PubMed
UniProtP17676|CEBPB_HUMAN CCAAT/enhancer-binding protein beta (Gene Name=CEBPB)

[Back to BioLiP]