Structure of PDB 2dze Chain A Binding Site BS01

Receptor Information
>2dze Chain A (length=160) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSIVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATS
QSYDQILDTLLVGPIPIGINKFVFEADPPNIDLLPQLSDVLGVTVILLSC
AYEDNEFVRVGYYVNNEMEGLNLQEMDDAEIKKVKVDISKVWRSILAEKP
RVTRFNIQWD
Ligand information
>2dze Chain X (length=6) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LARRLR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dze Crystal structure of histone chaperone Asf1 in complex with a C-terminus of histone H3
Resolution1.8 Å
Binding residue
(original residue number in PDB)
D37 D58 L60 L61 G63 E75
Binding residue
(residue number reindexed from 1)
D37 D58 L60 L61 G63 E75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2dze, PDBe:2dze, PDBj:2dze
PDBsum2dze
PubMed
UniProtO74515|ASF1_SCHPO Histone chaperone cia1 (Gene Name=cia1)

[Back to BioLiP]