Structure of PDB 2dxp Chain A Binding Site BS01

Receptor Information

>2dxp Chain A (length=158) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESWGDKDY
YLSILKKNGLQPLHIPIPDGGVPSDSQFLTIMKWLLSEKEGNLVHSVGGI
GRTGTILASYLILTEGLEVESAIDEVRLVRPGAVQTYEQEMFLLRVEGMR
KSWLKNIY

Ligand information

>2dxp Chain B (length=3) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AYR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2dxp Enzyme-substrate interactions revealed by the crystal structures of the archaeal Sulfolobus PTP-fold phosphatase and its phosphopeptide complexes
Resolution	2.1 Å
Binding residue (original residue number in PDB)	S96 V97 G98 I100 G101 R102 Q135
Binding residue (residue number reindexed from 1)	S96 V97 G98 I100 G101 R102 Q135

Enzymatic activity

Enzyme Commision number

3.1.3.48: protein-tyrosine-phosphatase.

Gene Ontology

	Molecular Function
GO:0004725	protein tyrosine phosphatase activity
GO:0016787	hydrolase activity

	Biological Process
GO:0006470	protein dephosphorylation
GO:0016311	dephosphorylation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2dxp, PDBe:2dxp, PDBj:2dxp
PDBsum	2dxp
PubMed	17173287
UniProt	Q97VZ7

[Back to BioLiP]