Structure of PDB 2dwx Chain A Binding Site BS01

Receptor Information
>2dwx Chain A (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVF
QSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRY
KLTFTMGDQTYNEMGDVDQFPPPETWGSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dwx Molecular Basis for Autoregulatory Interaction Between GAE Domain and Hinge Region of GGA1
Resolution2.55 Å
Binding residue
(original residue number in PDB)		Q561 S562 A563 V564 P565 K566 V570 L572 R609
Binding residue
(residue number reindexed from 1)		Q51 S52 A53 V54 P55 K56 V60 L62 R99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0031267 small GTPase binding
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0005802 trans-Golgi network

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2dwx, PDBe:2dwx, PDBj:2dwx
PDBsum2dwx
PubMed17506864
UniProtQ9UJY5|GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 (Gene Name=GGA1)

[Back to BioLiP]