Structure of PDB 2dwm Chain A Binding Site BS01

Receptor Information
>2dwm Chain A (length=105) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVS
DASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHAL
PILLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dwm Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		F16 D17 F36 K61
Binding residue
(residue number reindexed from 1)		F16 D17 F36 K61
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2dwm, PDBe:2dwm, PDBj:2dwm
PDBsum2dwm
PubMed17464287
UniProtP17888|PRIA_ECOLI Primosomal protein N' (Gene Name=priA)

[Back to BioLiP]