Structure of PDB 2dvs Chain A Binding Site BS01

Receptor Information
>2dvs Chain A (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMD
MGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKI
FLQKVASMPQEEQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dvs Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain.
Resolution2.04 Å
Binding residue
(original residue number in PDB)
N90 D94 I96
Binding residue
(residue number reindexed from 1)
N84 D88 I90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2dvs, PDBe:2dvs, PDBj:2dvs
PDBsum2dvs
PubMed20048151
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]