Structure of PDB 2dvr Chain A Binding Site BS01

Receptor Information
>2dvr Chain A (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMD
MGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKI
FLQKVASMPQEEQE
Ligand information
>2dvr Chain P (length=8) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGLGKGGA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dvr Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		V37 D46 I50 Y89 N90 T93 D94 D95 I96
Binding residue
(residue number reindexed from 1)		V31 D40 I44 Y83 N84 T87 D88 D89 I90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2dvr, PDBe:2dvr, PDBj:2dvr
PDBsum2dvr
PubMed20048151
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]