Structure of PDB 2drk Chain A Binding Site BS01

Receptor Information
>2drk Chain A (length=59) Species: 5755 (Acanthamoeba castellanii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGW
VPANYVQDI
Ligand information
>2drk Chain B (length=10) Species: 5755 (Acanthamoeba castellanii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPKPVPPPRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2drk The crystal structure of the SH3 domain of Acanthamoeba myosin IB bound to Acan125
Resolution1.42 Å
Binding residue
(original residue number in PDB)		L10 Y11 D12 Y13 E20 E25 G38 W39 N54 Y55
Binding residue
(residue number reindexed from 1)		L10 Y11 D12 Y13 E20 E25 G38 W39 N54 Y55
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2drk, PDBe:2drk, PDBj:2drk
PDBsum2drk
PubMed
UniProtP19706|MYSB_ACACA Myosin heavy chain IB (Gene Name=MIB)

[Back to BioLiP]